Recombinant Human UBR4/p600 Protein

Beta LifeScience SKU/CAT #: BLA-9456P
Recombinant Human UBR4/p600 Protein

Recombinant Human UBR4/p600 Protein

Beta LifeScience SKU/CAT #: BLA-9456P
Catalog No.: BLA-9456P

Product Overview

Host Species Human
Synonym 600 kDa retinoblastoma protein associated factor 600 kDa retinoblastoma protein-associated factor E3 ubiquitin-protein ligase UBR4 KIAA0462 KIAA1307 N-recognin-4 p600 RBAF600 Retinoblastoma associated factor 600 like protein Retinoblastoma associated factor of 600 kDa Retinoblastoma-associated factor 600 Retinoblastoma-associated factor of 600 kDa Ubiquitin protein ligase E3 component n recognin 4 UBR4 UBR4_HUMAN Zinc finger UBR1 type protein 1 Zinc finger UBR1-type protein 1 Zinc finger, UBR1 type 1 ZUBR 1 ZUBR1
Description Recombinant Human UBR4/p600 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence RNQLQSVAAACKVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRL DRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPVSPELRQKEVQ
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed