Recombinant Human UBR4/p600 Protein
Beta LifeScience
SKU/CAT #: BLA-9456P
Recombinant Human UBR4/p600 Protein
Beta LifeScience
SKU/CAT #: BLA-9456P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 600 kDa retinoblastoma protein associated factor 600 kDa retinoblastoma protein-associated factor E3 ubiquitin-protein ligase UBR4 KIAA0462 KIAA1307 N-recognin-4 p600 RBAF600 Retinoblastoma associated factor 600 like protein Retinoblastoma associated factor of 600 kDa Retinoblastoma-associated factor 600 Retinoblastoma-associated factor of 600 kDa Ubiquitin protein ligase E3 component n recognin 4 UBR4 UBR4_HUMAN Zinc finger UBR1 type protein 1 Zinc finger UBR1-type protein 1 Zinc finger, UBR1 type 1 ZUBR 1 ZUBR1 |
Description | Recombinant Human UBR4/p600 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | RNQLQSVAAACKVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRL DRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPVSPELRQKEVQ |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |