Recombinant Human UBP43/USP18 Protein

Beta LifeScience SKU/CAT #: BLA-9450P
Recombinant Human UBP43/USP18 Protein

Recombinant Human UBP43/USP18 Protein

Beta LifeScience SKU/CAT #: BLA-9450P
Catalog No.: BLA-9450P

Product Overview

Host Species Human
Synonym 43 kDa ISG15 specific protease 43 kDa ISG15-specific protease EC 3.1.2. hUBP43 Interferon Stimulated Gene 43 kD ISG15 Specific Processing Protease ISG15-specific-processing protease ISG43 Ubiquitin Specific Peptidase 18 Ubiquitin Specific Protease 18 Ubiquitin Specific Protease 18 43 kD Ubl carboxyl terminal hydrolase 18 Ubl carboxyl-terminal hydrolase 18 Ubl thioesterase 18 Ubl thiolesterase 18 Ubp15 UBP18_HUMAN USP18
Description Recombinant Human UBP43/USP18 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence LYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSGHYCVY IRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQETAYLLVYMKMEC
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed