Recombinant Human UBP43/USP18 Protein
Beta LifeScience
SKU/CAT #: BLA-9450P
Recombinant Human UBP43/USP18 Protein
Beta LifeScience
SKU/CAT #: BLA-9450P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 43 kDa ISG15 specific protease 43 kDa ISG15-specific protease EC 3.1.2. hUBP43 Interferon Stimulated Gene 43 kD ISG15 Specific Processing Protease ISG15-specific-processing protease ISG43 Ubiquitin Specific Peptidase 18 Ubiquitin Specific Protease 18 Ubiquitin Specific Protease 18 43 kD Ubl carboxyl terminal hydrolase 18 Ubl carboxyl-terminal hydrolase 18 Ubl thioesterase 18 Ubl thiolesterase 18 Ubp15 UBP18_HUMAN USP18 |
Description | Recombinant Human UBP43/USP18 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | LYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSGHYCVY IRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQETAYLLVYMKMEC |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |