Recombinant Human Ubiquitin (mutated K63 R) Protein

Beta LifeScience SKU/CAT #: BLA-9435P
Recombinant Human Ubiquitin (mutated K63 R) Protein

Recombinant Human Ubiquitin (mutated K63 R) Protein

Beta LifeScience SKU/CAT #: BLA-9435P
Catalog No.: BLA-9435P

Product Overview

Host Species Human
Synonym Epididymis secretory protein Li 50 FLJ25987 HEL S 50 MGC8385 Polyubiquitin B RPS 27A RPS27A UBA 52 UBA 80 UBA52 UBA80 UBB UBB_HUMAN UBC UBCEP 1 UBCEP 2 UBCEP1 UBCEP2 Ubiquitin Ubiquitin B
Description Recombinant Human Ubiquitin (mutated K63 R) Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLSDYNIQRESTLHLVLRLRGG
Molecular Weight 9 kDa
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed