Recombinant Human UBF1 Protein

Beta LifeScience SKU/CAT #: BLA-9430P
Recombinant Human UBF1 Protein

Recombinant Human UBF1 Protein

Beta LifeScience SKU/CAT #: BLA-9430P
Catalog No.: BLA-9430P

Product Overview

Host Species Human
Synonym 90 kDa nucleolus organizer region autoantigen Autoantigen NOR-90 NOR 90 Nucleolar transcription factor 1 UBF UBF 1 UBF-1 UBF1_HUMAN Ubtf Upstream binding factor 1 upstream binding transcription factor, RNA polymerase I Upstream-binding factor 1
Description Recombinant Human UBF1 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEI GSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed