Recombinant Human UBF1 Protein
Beta LifeScience
SKU/CAT #: BLA-9430P
Recombinant Human UBF1 Protein
Beta LifeScience
SKU/CAT #: BLA-9430P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 90 kDa nucleolus organizer region autoantigen Autoantigen NOR-90 NOR 90 Nucleolar transcription factor 1 UBF UBF 1 UBF-1 UBF1_HUMAN Ubtf Upstream binding factor 1 upstream binding transcription factor, RNA polymerase I Upstream-binding factor 1 |
Description | Recombinant Human UBF1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEI GSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |