Recombinant Human UBE3A Protein

Beta LifeScience SKU/CAT #: BLA-9427P
Recombinant Human UBE3A Protein

Recombinant Human UBE3A Protein

Beta LifeScience SKU/CAT #: BLA-9427P
Catalog No.: BLA-9427P

Product Overview

Host Species Human
Accession Q05086
Synonym ANCR Angelman syndrome AS CTCL tumor antigen se37 2 CTCL tumor antigen se37-2 E6 AP E6AP E6AP ubiquitin protein ligase E6AP ubiquitin-protein ligase EPVE6AP FLJ26981 HECT-type ubiquitin transferase E3A HPVE6A Human papilloma virus E6 associated protein Human papilloma virus E6 associated protein Angelman syndrome Human papillomavirus E6-associated protein NY REN 54 antigen Oncogenic protein associated protein E6 AP Oncogenic protein associated protein E6AP Oncogenic protein-associated protein E6-AP Renal carcinoma antigen NY REN 54 Renal carcinoma antigen NY-REN-54 UBE 3A Ube3a UBE3A protein UBE3A_HUMAN Ubiquitin protein ligase E3A Ubiquitin-protein ligase E3A
Description Recombinant Human UBE3A Protein was expressed in Baculovirus infected Sf21 cells. It is a Full length protein
Source Baculovirus infected Sf21 cells
AA Sequence MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACT NEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENS KGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLI RVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSA AAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSNE KIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPE YLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYK VISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEP IPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCRKPLIPFEEFI NEPLNEVLEMDKDYTFFKVETENKFSFMTCPFILNAVTKNLGLYYDNRIR MYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMIAMENPAD LKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFW FNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRD LGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENG DKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLF RPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDE QKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLP EYSSKEKLKERLLKAITYAKGFGML
Molecular Weight 102 kDa including tags
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Typical enzyme concentration to support conjugation in vitro is 1-5 μMdepending on experimental conditions.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed