Recombinant Human UBE2W Protein

Beta LifeScience SKU/CAT #: BLA-9423P
Recombinant Human UBE2W Protein

Recombinant Human UBE2W Protein

Beta LifeScience SKU/CAT #: BLA-9423P
Catalog No.: BLA-9423P

Product Overview

Host Species Human
Accession Q96B02-2
Synonym FLJ11011 hUBC 16 hUBC16 Probable ubiquitin conjugating enzyme E2 W Probable ubiquitin-conjugating enzyme E2 W UBC 16 UBC-16 UBC16 UBE 2W ube2w UBE2W_HUMAN Ubiquitin carrier protein W Ubiquitin conjugating enzyme 16 Ubiquitin conjugating enzyme E2 W Ubiquitin conjugating enzyme E2W Ubiquitin protein ligase W Ubiquitin-protein ligase W
Description Recombinant Human UBE2W Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MASMQTTGRRVEVWFPKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIV DMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGH ICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNP KKTKWWYHDDTC
Molecular Weight 20 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Typical enzyme concentration to support conjugation in vitro is 100 nM-1 µM depending on conditions.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed