Recombinant Human UBE2W Protein
Beta LifeScience
SKU/CAT #: BLA-9423P
Recombinant Human UBE2W Protein
Beta LifeScience
SKU/CAT #: BLA-9423P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q96B02-2 |
Synonym | FLJ11011 hUBC 16 hUBC16 Probable ubiquitin conjugating enzyme E2 W Probable ubiquitin-conjugating enzyme E2 W UBC 16 UBC-16 UBC16 UBE 2W ube2w UBE2W_HUMAN Ubiquitin carrier protein W Ubiquitin conjugating enzyme 16 Ubiquitin conjugating enzyme E2 W Ubiquitin conjugating enzyme E2W Ubiquitin protein ligase W Ubiquitin-protein ligase W |
Description | Recombinant Human UBE2W Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MASMQTTGRRVEVWFPKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIV DMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGH ICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNP KKTKWWYHDDTC |
Molecular Weight | 20 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Typical enzyme concentration to support conjugation in vitro is 100 nM-1 µM depending on conditions. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |