Recombinant Human UBE2V1 Protein (BSA and azide free)

Beta LifeScience SKU/CAT #: BLA-9421P
Recombinant Human UBE2V1 Protein (BSA and azide free)

Recombinant Human UBE2V1 Protein (BSA and azide free)

Beta LifeScience SKU/CAT #: BLA-9421P
Catalog No.: BLA-9421P

Product Overview

Host Species Human
Accession Q13404
Synonym CIR1 CROC-1 CROC1 CROC1A TRAF6-regulated IKK activator 1 beta Uev1A UB2V1_HUMAN UBE2V UBE2V 1 UBE2V1 Ubiquitin conjugating enzyme E2 variant 1 Ubiquitin-conjugating enzyme E2 variant 1 UEV-1 UEV1
Description Recombinant Human UBE2V1 Protein (BSA and azide free) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTG MIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVV DPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSNLEH HHHHH
Molecular Weight 18 kDa including tags
Purity >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed