Recombinant Human UBE2V1 Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-9421P
Recombinant Human UBE2V1 Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-9421P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q13404 |
Synonym | CIR1 CROC-1 CROC1 CROC1A TRAF6-regulated IKK activator 1 beta Uev1A UB2V1_HUMAN UBE2V UBE2V 1 UBE2V1 Ubiquitin conjugating enzyme E2 variant 1 Ubiquitin-conjugating enzyme E2 variant 1 UEV-1 UEV1 |
Description | Recombinant Human UBE2V1 Protein (BSA and azide free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTG MIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVV DPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSNLEH HHHHH |
Molecular Weight | 18 kDa including tags |
Purity | >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |