Recombinant Human Ube2L6 Protein

Beta LifeScience SKU/CAT #: BLA-9410P
Recombinant Human Ube2L6 Protein

Recombinant Human Ube2L6 Protein

Beta LifeScience SKU/CAT #: BLA-9410P
Catalog No.: BLA-9410P

Product Overview

Host Species Human
Accession O14933
Synonym MGC40331 Retinoic acid induced gene B protein Retinoic acid-induced gene B protein RIG B RIG-B UB2L6_HUMAN UBCH 8 UbcH8 UBE2L6 Ubiquitin carrier protein Ubiquitin carrier protein L6 Ubiquitin conjugating enzyme E2L 6 Ubiquitin protein ligase Ubiquitin protein ligase L6 Ubiquitin-protein ligase L6 Ubiquitin/ISG15 conjugating enzyme E2 L6 Ubiquitin/ISG15-conjugating enzyme E2 L6
Description Recombinant Human Ube2L6 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKA FNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTK TCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVD RPS
Purity >85% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity The specific activity ofthis protein was determined to be 13 nmol/min/mg in SUMOylationn assay using human ISG15 protein substrate.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed