Recombinant Human Ube2L6 Protein
Beta LifeScience
SKU/CAT #: BLA-9408P
Recombinant Human Ube2L6 Protein
Beta LifeScience
SKU/CAT #: BLA-9408P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O14933 |
Synonym | MGC40331 Retinoic acid induced gene B protein Retinoic acid-induced gene B protein RIG B RIG-B UB2L6_HUMAN UBCH 8 UbcH8 UBE2L6 Ubiquitin carrier protein Ubiquitin carrier protein L6 Ubiquitin conjugating enzyme E2L 6 Ubiquitin protein ligase Ubiquitin protein ligase L6 Ubiquitin-protein ligase L6 Ubiquitin/ISG15 conjugating enzyme E2 L6 Ubiquitin/ISG15-conjugating enzyme E2 L6 |
Description | Recombinant Human Ube2L6 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKA FNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTK TCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVD RPS |
Molecular Weight | 17 kDa including tags |
Purity | >85% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |