Recombinant Human UBE2D3 Protein

Beta LifeScience SKU/CAT #: BLA-9386P
Recombinant Human UBE2D3 Protein

Recombinant Human UBE2D3 Protein

Beta LifeScience SKU/CAT #: BLA-9386P
Catalog No.: BLA-9386P

Product Overview

Host Species Human
Accession P61077
Synonym E2(17)KB3 MGC43926 MGC5416 PRO2116 UB2D3_HUMAN UBC 4/5 UBC4/5 UBC4/5 homolog yeast UBC4/5, S. cerevisiae, homolog of UBCH 5C UBCH5C Ube2d3 Ubiquitin carrier protein Ubiquitin carrier protein D3 Ubiquitin conjugating enzyme E2 17 kDa 3 Ubiquitin conjugating enzyme E2 D3 Ubiquitin conjugating enzyme E2D 3 Ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5) Ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog yeast) Ubiquitin protein ligase D3 Ubiquitin-conjugating enzyme E2 D3 Ubiquitin-conjugating enzyme E2(17)KB 3 Ubiquitin-conjugating enzyme E2-17 kDa 3 Ubiquitin-protein ligase D3
Description Recombinant Human UBE2D3 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF FLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTIS KVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Molecular Weight 17 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed