Recombinant Human UBC6e Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9377P
Recombinant Human UBC6e Protein (Tagged)

Recombinant Human UBC6e Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9377P
Catalog No.: BLA-9377P

Product Overview

Host Species Human
Accession Q9Y385
Synonym CGI-76 HSPC153 HSPC205 HSU93243 HSUBC6e MGC12555 NCUBE-1 NCUBE1 Non-canonical ubiquitin-conjugating enzyme 1 UB2J1_HUMAN UBC6 UBC6E Ubc6p Ube2j1 Ubiquitin conjugating enzyme E2, J1 (UBC6 homolog, yeast) Ubiquitin conjugating enzyme E2, J1, U Ubiquitin-conjugating enzyme E2 J1 Yeast ubiquitin-conjugating enzyme UBC6 homolog E
Description Recombinant Human UBC6e Protein (Tagged) was expressed in Baculovirus infected Sf9 cells. It is a Full length protein
Source Baculovirus infected Sf9 cells
AA Sequence METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD SDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPE TWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCE GCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESD LNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSM SPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTDHGGSAVLIVILTLALAA LIFRRIYLANEYIFDFEL
Molecular Weight 70 kDa including tags
Purity >70% Densitometry.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed