Recombinant Human Uba6 Protein
Beta LifeScience
SKU/CAT #: BLA-9367P
Recombinant Human Uba6 Protein
Beta LifeScience
SKU/CAT #: BLA-9367P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | A0AVT1-3 |
Synonym | E1-L2 FLJ10808 FLJ23367 Monocyte protein 4 MOP 4 MOP-4 MOP4 UBA 6 Uba6 UBA6 ubiquitin activating enzyme E1 UBA6_HUMAN UBE1L2 Ubiquitin activating enzyme 6 Ubiquitin activating enzyme E1 like 2 Ubiquitin activating enzyme E1 like protein 2 Ubiquitin like modifier activating enzyme 6 Ubiquitin-activating enzyme 6 Ubiquitin-activating enzyme E1-like protein 2 Ubiquitin-like modifier-activating enzyme 6 |
Description | Recombinant Human Uba6 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYV LGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWD LGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSF LDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFG DEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREI NGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFE SLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQD SEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY |
Molecular Weight | 68 kDa |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |