Recombinant Human Uba6 Protein

Beta LifeScience SKU/CAT #: BLA-9367P
Recombinant Human Uba6 Protein

Recombinant Human Uba6 Protein

Beta LifeScience SKU/CAT #: BLA-9367P
Catalog No.: BLA-9367P

Product Overview

Host Species Human
Accession A0AVT1-3
Synonym E1-L2 FLJ10808 FLJ23367 Monocyte protein 4 MOP 4 MOP-4 MOP4 UBA 6 Uba6 UBA6 ubiquitin activating enzyme E1 UBA6_HUMAN UBE1L2 Ubiquitin activating enzyme 6 Ubiquitin activating enzyme E1 like 2 Ubiquitin activating enzyme E1 like protein 2 Ubiquitin like modifier activating enzyme 6 Ubiquitin-activating enzyme 6 Ubiquitin-activating enzyme E1-like protein 2 Ubiquitin-like modifier-activating enzyme 6
Description Recombinant Human Uba6 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYV LGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWD LGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSF LDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFG DEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREI NGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFE SLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQD SEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY
Molecular Weight 68 kDa
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed