Recombinant Human UBA3 Protein

Beta LifeScience SKU/CAT #: BLA-9362P
Recombinant Human UBA3 Protein

Recombinant Human UBA3 Protein

Beta LifeScience SKU/CAT #: BLA-9362P
Catalog No.: BLA-9362P

Product Overview

Host Species Human
Accession Q8TBC4
Synonym DKFZp566J164 EC 6.3.2. hUba3 MGC22384 NEDD8 activating enzyme E1 catalytic subunit NEDD8 activating enzyme E1C Nedd8 activating enzyme hUba3 NEDD8-activating enzyme E1 catalytic subunit NEDD8-activating enzyme E1C uba3 UBA3 ubiquitin activating enzyme E1 homolog UBA3_HUMAN UBE1C Ubiquitin activating enzyme 3 Ubiquitin activating enzyme E1C Ubiquitin-activating enzyme 3 Ubiquitin-activating enzyme E1C Ubiquitin-like modifier-activating enzyme 3
Description Recombinant Human UBA3 Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein
Source Baculovirus infected Sf9 cells
AA Sequence MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGP FTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVID MDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQD FNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLID GGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCI EYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYR LTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDG LYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSP AITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVT TPQTVLFKLHFTS
Molecular Weight 73 kDa including tags
Purity >95% Densitometry.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed