Recombinant Human UAP56 Protein

Beta LifeScience SKU/CAT #: BLA-9360P
Recombinant Human UAP56 Protein

Recombinant Human UAP56 Protein

Beta LifeScience SKU/CAT #: BLA-9360P
Catalog No.: BLA-9360P

Product Overview

Host Species Human
Accession Q13838
Synonym 0610030D10Rik 4F2-LC6 56 kDa U2AF65-associated protein AI428441 ATP-dependent RNA helicase p47 B(0,+)-type amino acid transporter 1 BAT1 Bat1a D17H6S81E D17H6S81E-1 D6S81E D6S81Eh DDX39B DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B DEAD box protein UAP56 DX39B_HUMAN EC 3.6.1.- Glycoprotein-associated amino acid transporter b0,+AT1 HLA-B-associated transcript 1 protein HLA-B-associated transcript 1A HLA-B-associated transcript-1 MGC127051 MGC19235 MGC38799 nuclear RNA helicase (DEAD family) OTTHUMP00000029229 OTTHUMP00000165889 OTTHUMP00000165890 p47 Solute carrier family 7 member 9 Spliceosome RNA helicase BAT1 Spliceosome RNA helicase DDX39B U2AF65-associayed protein, 56-KD UAP56
Description Recombinant Human UAP56 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMAENDVDNELLDYEDDEVETAAGGDGAEAP AKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI LGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQIS KEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALA RNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSAT LSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFD LLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRY QQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGR FGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Molecular Weight 51 kDa including tags
Purity >90% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed