Recombinant Human U1-C Protein
Beta LifeScience
SKU/CAT #: BLA-9358P
Recombinant Human U1-C Protein
Beta LifeScience
SKU/CAT #: BLA-9358P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P09234 |
Synonym | FLJ20302 OTTHUMP00000016238 OTTMUSP00000026897 RU1C_HUMAN Small nuclear ribonucleoprotein polypeptide C Snrpc U1 C U1 small nuclear ribonucleoprotein 1C U1 small nuclear ribonucleoprotein C U1 small nuclear RNP specific C U1 snRNP C U1 snRNP protein C U1-C U1C U1C protein Yhc1 |
Description | Recombinant Human U1-C Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLI DKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGP PMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPT RPGMTRPDR |
Molecular Weight | 44 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |