Recombinant Human U1-C Protein

Beta LifeScience SKU/CAT #: BLA-9358P
Recombinant Human U1-C Protein

Recombinant Human U1-C Protein

Beta LifeScience SKU/CAT #: BLA-9358P
Catalog No.: BLA-9358P

Product Overview

Host Species Human
Accession P09234
Synonym FLJ20302 OTTHUMP00000016238 OTTMUSP00000026897 RU1C_HUMAN Small nuclear ribonucleoprotein polypeptide C Snrpc U1 C U1 small nuclear ribonucleoprotein 1C U1 small nuclear ribonucleoprotein C U1 small nuclear RNP specific C U1 snRNP C U1 snRNP protein C U1-C U1C U1C protein Yhc1
Description Recombinant Human U1-C Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLI DKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGP PMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPT RPGMTRPDR
Molecular Weight 44 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed