Recombinant Human TXNL4B Protein

Beta LifeScience SKU/CAT #: BLA-9344P
Recombinant Human TXNL4B Protein

Recombinant Human TXNL4B Protein

Beta LifeScience SKU/CAT #: BLA-9344P
Catalog No.: BLA-9344P

Product Overview

Host Species Human
Accession Q9NX01
Synonym AI595343 D530025J19Rik Dim1 like protein Dim1-like protein DIM2 DLP FLJ20511 MGC109322 RGD1305127 Thioredoxin like 4B Thioredoxin like protein 4B Thioredoxin-like protein 4B TXN4B_HUMAN Txnl4b
Description Recombinant Human TXNL4B Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSFLLPKLTSKKEV DQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVD QTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFID LIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Molecular Weight 21 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed