Recombinant Human TXNDC4 Protein

Beta LifeScience SKU/CAT #: BLA-9339P
Recombinant Human TXNDC4 Protein

Recombinant Human TXNDC4 Protein

Beta LifeScience SKU/CAT #: BLA-9339P
Catalog No.: BLA-9339P

Product Overview

Host Species Human
Accession Q9BS26
Synonym Endoplasmic reticulum resident protein 44 Endoplasmic reticulum resident protein 44 kDa Endoplasmic reticulum resident protein ERp44 ER protein 44 ERp44 ERP44_HUMAN KIAA0573 PDIA10 Protein disulfide isomerase family A, member 10 Thioredoxin domain containing 4 (endoplasmic reticulum) Thioredoxin domain containing protein 4 Thioredoxin domain-containing protein 4 UNQ532/PRO1075
Description Recombinant Human TXNDC4 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWAGSMEITSLDTENIDE ILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVD CDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKS DPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAF LSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKC VPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEK GTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIP GKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLA PSEYRYTLLRDRDEL
Molecular Weight 48 kDa including tags
Purity >90% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed