Recombinant Human Twinkle Protein

Beta LifeScience SKU/CAT #: BLA-9332P
Recombinant Human Twinkle Protein

Recombinant Human Twinkle Protein

Beta LifeScience SKU/CAT #: BLA-9332P
Catalog No.: BLA-9332P

Product Overview

Host Species Human
Synonym Ataxin 8 Ataxin8 ATXN 8 ATXN8 C10 orf2 C10orf 2 C10orf2 Chromosome 10 open reading frame 2 IOSCA mitochondrial MTDPS7 PEO PEO 1 PEO1 PEO1_HUMAN PEOA3 Progressive external ophthalmoplegia 1 protein SANDO SCA 8 SCA8 T7 gp4 like protein with intramitochondrial nucleoid localization T7 gp4-like protein with intramitochondrial nucleoid localization T7 helicase-related protein with intramitochondrial nucleoid localization T7 like mitochondrial DNA helicase T7-like mitochondrial DNA helicase Twinkle protein Twinkle protein, mitochondrial TWINL
Description Recombinant Human Twinkle Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MFGLTKVTDDTLKRFSVRYLRPARSLVFPWFSPGGSGLRGLKLLEAKCQG DGVSYEETTIPRPSAYHNLFGLPLISRRDAEVVLTSRELDSLALNQSTGL PTLTLPRGTTCLPPALLPYLEQFRRIVFWLGDDLRSWEAAKLFARKLNPK RCFLVRPGDQQPRPLEALNGGFNLSRILRTALPAWHKSIVSFRQLREEVL GELSNVEQAAGLRWSRFPDLNRILKGHRKGELTVFTGPTGSGKTTFISEY ALDLCSQGVNTLWGSFEISNVRLARVMLTQFAEGRLEDQLDKYDHWADRF EDLPLYFMTFHGQQSIRTVIDTMQHAVYVYDICHVIIDNLQFMMGHEQLS TDRIAAQDYIIGVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAK ASQEADNVLILQDRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTF SIPPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPD TSKRSK
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed