Recombinant Human TWEAKR/FN14 Protein (Fc Tag His Tag)

Beta LifeScience SKU/CAT #: BLA-9327P
Recombinant Human TWEAKR/FN14 Protein (Fc Tag His Tag)

Recombinant Human TWEAKR/FN14 Protein (Fc Tag His Tag)

Beta LifeScience SKU/CAT #: BLA-9327P
Catalog No.: BLA-9327P

Product Overview

Host Species Human
Accession Q9NP84
Synonym CD 266 CD266 CD266 antigen FGF inducible 14 FGF-inducible 14 Fibroblast growth factor inducible immediate early response protein 14 Fibroblast growth factor-inducible immediate-early response protein 14 FN 14 FN14 TNFRSF 12A TNFRSF12A TNR12_HUMAN Tumor necrosis factor receptor superfamily member 12A TWEAK R Tweak receptor Tweak-receptor TweakR
Description Recombinant Human TWEAKR/FN14 Protein (Fc Tag His Tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment
Source Baculovirus infected insect cells
AA Sequence EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRL LWPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Molecular Weight 33 kDa including tags
Purity >90% SDS-PAGE.Purified using conventional chromatography techniques.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed