Recombinant Human TWEAKR/FN14 Protein

Beta LifeScience SKU/CAT #: BLA-9324P
Recombinant Human TWEAKR/FN14 Protein

Recombinant Human TWEAKR/FN14 Protein

Beta LifeScience SKU/CAT #: BLA-9324P
Catalog No.: BLA-9324P

Product Overview

Host Species Human
Accession Q9NP84
Synonym CD 266 CD266 CD266 antigen FGF inducible 14 FGF-inducible 14 Fibroblast growth factor inducible immediate early response protein 14 Fibroblast growth factor-inducible immediate-early response protein 14 FN 14 FN14 TNFRSF 12A TNFRSF12A TNR12_HUMAN Tumor necrosis factor receptor superfamily member 12A TWEAK R Tweak receptor Tweak-receptor TweakR
Description Recombinant Human TWEAKR/FN14 Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRL LWP
Molecular Weight 6 kDa
Purity >95% SDS-PAGE.> 95 % by HPLC.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Fully biologically active when compared to standard.The ED50 as determined by inhibiting TWEAK-dependent proliferation of Human umbilical vein endothelial cells (HUVEC) is less than 30 ng/ml, corresponding to a specific activity of > 3.3 x 104 IU/mg, in the presence of 15 ng/ml of TWEAKR.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
Recently viewed