Recombinant Human TUSC2/FUS1 Protein

Beta LifeScience SKU/CAT #: BLA-9319P
Recombinant Human TUSC2/FUS1 Protein

Recombinant Human TUSC2/FUS1 Protein

Beta LifeScience SKU/CAT #: BLA-9319P
Catalog No.: BLA-9319P

Product Overview

Host Species Human
Synonym C3orf11 Fus-1 protein FUS1 Fusion 1 protein LGCC PAP PDAP2 PDGFA associated protein 2 PDGFA-associated protein 2 Tumor suppressor candidate 2 TUSC 2 Tusc2 TUSC2_HUMAN
Description Recombinant Human TUSC2/FUS1 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence ALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLR RVHKNLIPQGIVKLDHPRIHVDFPVILYEV
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed