Recombinant Human TUSC2/FUS1 Protein
Beta LifeScience
SKU/CAT #: BLA-9319P
Recombinant Human TUSC2/FUS1 Protein
Beta LifeScience
SKU/CAT #: BLA-9319P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | C3orf11 Fus-1 protein FUS1 Fusion 1 protein LGCC PAP PDAP2 PDGFA associated protein 2 PDGFA-associated protein 2 Tumor suppressor candidate 2 TUSC 2 Tusc2 TUSC2_HUMAN |
Description | Recombinant Human TUSC2/FUS1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | ALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLR RVHKNLIPQGIVKLDHPRIHVDFPVILYEV |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |