Recombinant Human TTBK1 Protein

Beta LifeScience SKU/CAT #: BLA-9300P
Recombinant Human TTBK1 Protein

Recombinant Human TTBK1 Protein

Beta LifeScience SKU/CAT #: BLA-9300P
Catalog No.: BLA-9300P

Product Overview

Host Species Human
Accession Q5TCY1
Synonym BDTK Brain derived tau kinase Brain-derived tau kinase KIAA1855 Tau tubulin kinase 1 Tau-tubulin kinase 1 TTBK1 TTBK1_HUMAN
Description Recombinant Human TTBK1 Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment
Source Baculovirus infected Sf9 cells
AA Sequence MQCLAAALKDETNMSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYE AMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNE KFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGF LHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFR GTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGM IKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKER GIAENEAFDWEKAGTDALLSTSTSTPPQQNTRQTAAMFGVVNVTPVPGDL LRENTEDVLQGEHLSDQENAPPILPGRPSEGLGPSPHLVPHPGGPEAEVW EETDVNRNKLRINIGKSPCVEEEQSRGMGVPSSPVRAPPDSPTTPVRSLR YRRVNSPESERLSTADGRVELPERRSRMD
Purity >85% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity The specific activity ofthis protein was170 nmol/min/mg in akinase assay usingmyelin basic proteinas substrate.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed