Recombinant Human TSSK6 Protein (BSA and azide free) (denatured)

Beta LifeScience SKU/CAT #: BLA-9295P
Recombinant Human TSSK6 Protein (BSA and azide free) (denatured)

Recombinant Human TSSK6 Protein (BSA and azide free) (denatured)

Beta LifeScience SKU/CAT #: BLA-9295P
Catalog No.: BLA-9295P

Product Overview

Host Species Human
Accession Q9BXA6
Synonym Cancer/testis antigen 72 CT72 EC 2.7.11.1 FKSG82 FLJ24002 RGD1559764 Serine/threonine-protein kinase SSTK Small serine/threonine kinase Small serine/threonine protein kinase SSTK testis-specific serine kinase 6 Testis-specific serine/threonine kinase 6 Testis-specific serine/threonine-protein kinase 6 TSK 6 TSSK4 TSSK6
Description Recombinant Human TSSK6 Protein (BSA and azide free) (denatured) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMSGDKLLSELGYKLGRTIGEGSYSKVK VATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFE FIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLH DHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAY ASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRG VLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Molecular Weight 33 kDa including tags
Purity >80% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed