Recombinant Human TSSK2 Protein

Beta LifeScience SKU/CAT #: BLA-9291P
Recombinant Human TSSK2 Protein

Recombinant Human TSSK2 Protein

Beta LifeScience SKU/CAT #: BLA-9291P
Catalog No.: BLA-9291P

Product Overview

Host Species Human
Accession Q96PF2
Synonym DGS-G DGSG DiGeorge syndrome protein G Serine/threonine kinase 22B (spermiogenesis associated) Serine/threonine protein kinase 22B Serine/threonine-protein kinase 22B Spermiogenesis associated 2 SPOGA2 STK22B Testis specific kinase 2 Testis specific serine kinase 2 Testis specific serine threonine kinase 2 Testis specific serine/threonine protein kinase 2 Testis-specific kinase 2 Testis-specific serine/threonine-protein kinase 2 TSK 2 TSK-2 TSK2 TSSK 2 TSSK-2 Tssk2 TSSK2_HUMAN
Description Recombinant Human TSSK2 Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein
Source Baculovirus infected Sf9 cells
AA Sequence MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPT DFVERFLPREMDILATVNHGSIIKTYEIFETSDGRIYIIMELGVQGDLLE FIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCENLLLDKDFNI KLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIW SLGVILYIMVCGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIY RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD TKTGLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISG AEVGKAST
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity The specific activity ofthis protein was136 nmol/min/mg in akinase assay usingmyelin basicprotein as substrate.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed