Recombinant Human TSSK1 Protein

Beta LifeScience SKU/CAT #: BLA-9288P
Recombinant Human TSSK1 Protein

Recombinant Human TSSK1 Protein

Beta LifeScience SKU/CAT #: BLA-9288P
Catalog No.: BLA-9288P

Product Overview

Host Species Human
Accession Q9BXA7
Synonym FKSG81 serine/threonine kinase 22D (spermiogenesis associated) serine/threonine kinase FKSG81 Serine/threonine-protein kinase 22A spermiogenesis associated 4 SPOGA1 SPOGA4 STK22A STK22D Testis specific kinase 1 Testis specific serine kinase 1 testis specific serine kinase 1B Testis-specific kinase 1 Testis-specific serine/threonine-protein kinase 1 TSK 1 TSK-1 TSK1 TSSK-1 TSSK1_HUMAN Tssk1b
Description Recombinant Human TSSK1 Protein was expressed in Baculovirus. It is a Full length protein
Source Baculovirus
AA Sequence MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPA DFLEKFLPREIEILAMLNHCSIIKTYEIFETSHGKVYIVMELAVQGDLLE LIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCDNLLLDKDFNI KLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIW SLGVILYIMVCGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGECKDLIY HMLQPDVNRRLHIDEILSHCWMQPKARGSPSVAINKEGESSRGTEPLWTP EPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPST METEEGPPQQPPETRAQ
Molecular Weight 71 kDa including tags
Purity >80% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity The specific activity of TSSK1 was determined to be 60 nmol/min/mg.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed