Recombinant Human TSSC3 Protein

Beta LifeScience SKU/CAT #: BLA-9287P
Recombinant Human TSSC3 Protein

Recombinant Human TSSC3 Protein

Beta LifeScience SKU/CAT #: BLA-9287P
Catalog No.: BLA-9287P

Product Overview

Host Species Human
Accession Q53GA4
Synonym Beckwith Wiedemann syndrome chromosome region 1 candidate protein C Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein BRW 1C BRW1C BWR 1C BWR1C HLDA 2 HLDA2 Imprinted in placenta and liver Imprinted in placenta and liver protein IPL p17 Beckwith Wiedemann region 1C p17 BWR1C p17-Beckwith-Wiedemann region 1 C p17-BWR1C PHLA2_HUMAN PHLDA 2 phlda2 Pleckstrin homology like domain family A member 2 Pleckstrin homology-like domain family A member 2 TSSC 3 Tumor suppressing STF cDNA 3 protein Tumor suppressing subchromosomal transferable fragment candidate gene 3 protein Tumor suppressing subchromosomal transferable fragment cDNA 3 Tumor suppressing subtransferable candidate 3 Tumor supressing STF cDNA 3 Tumor-suppressing STF cDNA 3 protein Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein
Description Recombinant Human TSSC3 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKEL RFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALID FQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPR TPLEHHHHHH
Molecular Weight 18 kDa including tags
Purity >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed