Recombinant Human TSR2 Protein

Beta LifeScience SKU/CAT #: BLA-9285P
Recombinant Human TSR2 Protein

Recombinant Human TSR2 Protein

Beta LifeScience SKU/CAT #: BLA-9285P
Catalog No.: BLA-9285P

Product Overview

Host Species Human
Accession Q969E8
Synonym DT1P1A10 Pre-rRNA-processing protein TSR2 homolog RP1 112K5 2 tsr2 TSR2 20S rRNA accumulation homolog TSR2 20S rRNA accumulation homolog S cerevisiae TSR2_HUMAN WGG motif containing 1 WGG1
Description Recombinant Human TSR2 Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMAGAAEDARALFRAGVCAALEAWPALQ IAVENGFGGVHSQEKAKWLGGAVEDYFMRNADLELDEVEDFLGELLTNEF DTVVEDGSLPQVSQQLQTMFHHFQRGDGAALREMASCITQRKCKVTATAL KTARETDEDDDVDSVEEMEVTATNDGAATDGVCPQPEPSDPDAQTIKEED IVEDGWTIVRRK
Molecular Weight 23 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed