Recombinant Human TSR2 Protein
Beta LifeScience
SKU/CAT #: BLA-9285P
Recombinant Human TSR2 Protein
Beta LifeScience
SKU/CAT #: BLA-9285P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q969E8 |
Synonym | DT1P1A10 Pre-rRNA-processing protein TSR2 homolog RP1 112K5 2 tsr2 TSR2 20S rRNA accumulation homolog TSR2 20S rRNA accumulation homolog S cerevisiae TSR2_HUMAN WGG motif containing 1 WGG1 |
Description | Recombinant Human TSR2 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMAGAAEDARALFRAGVCAALEAWPALQ IAVENGFGGVHSQEKAKWLGGAVEDYFMRNADLELDEVEDFLGELLTNEF DTVVEDGSLPQVSQQLQTMFHHFQRGDGAALREMASCITQRKCKVTATAL KTARETDEDDDVDSVEEMEVTATNDGAATDGVCPQPEPSDPDAQTIKEED IVEDGWTIVRRK |
Molecular Weight | 23 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |