Recombinant Human TSPAN3 Protein

Beta LifeScience SKU/CAT #: BLA-9283P
Recombinant Human TSPAN3 Protein

Recombinant Human TSPAN3 Protein

Beta LifeScience SKU/CAT #: BLA-9283P
Catalog No.: BLA-9283P

Product Overview

Host Species Human
Synonym Tetraspan 3 Tetraspan TM4SF tetraspanin 3 tetraspanin TM4 A TM4 A TM4A TM4SF8 transmembrane 4 superfamily member 8 TSPAN 3 TSPAN3
Description Recombinant Human TSPAN3 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYT LIPAVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVV VVLGYVYRAKVENEVDRSIQKVYKTYNGTNPDAASRAIDYVQRQLHCCGI HNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEAL VVKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRDPAYELLITGG TYA
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed