Recombinant Human TRPV5 Protein

Beta LifeScience SKU/CAT #: BLA-9272P
Recombinant Human TRPV5 Protein

Recombinant Human TRPV5 Protein

Beta LifeScience SKU/CAT #: BLA-9272P
Catalog No.: BLA-9272P

Product Overview

Host Species Human
Synonym Calcium transport protein 2 Calcium transporter 2 CAT 2 CAT2 ECaC ECAC 1 ECaC1 Epithelial calcium channel 1 Osm 9 like TRP channel 3 Osm-9-like TRP channel 3 OTRPC 3 OTRPC3 Transient receptor potential cation channel subfamily V member 5 TRPV 5 TrpV5 TRPV5_HUMAN
Description Recombinant Human TRPV5 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLL RASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAALYDNLEAALVLME
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed