Recombinant Human TRPM7 Protein

Beta LifeScience SKU/CAT #: BLA-9270P
Recombinant Human TRPM7 Protein

Recombinant Human TRPM7 Protein

Beta LifeScience SKU/CAT #: BLA-9270P
Catalog No.: BLA-9270P

Product Overview

Host Species Human
Synonym ALSPDC CHAK CHAK1 Channel kinase 1 Channel-kinase 1 Long transient receptor potential channel 7 LTrpC-7 LTrpC7 Transient receptor potential cation channel subfamily M member 7 TRP PLIK TRPM7 TRPM7_HUMAN
Description Recombinant Human TRPM7 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence KTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEG KNEMEIQMKSKKLPITRKFYAFYHAPIVK
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed