Recombinant Human TRPC6 Protein

Beta LifeScience SKU/CAT #: BLA-9269P
Recombinant Human TRPC6 Protein

Recombinant Human TRPC6 Protein

Beta LifeScience SKU/CAT #: BLA-9269P
Catalog No.: BLA-9269P

Product Overview

Host Species Human
Accession Q9Y210
Synonym bZ1P14.9 FLJ11098 FLJ14863 FSGS2 MTRP6 Short transient receptor potential channel 6 si:rp71-1p14.9 Transient receptor potential cation channel subfamily C member 6 Transient receptor protein 6 TRP 6 TRP-6 TRP6 TRPC 6 Trpc6 TRPC6_HUMAN TRRP6
Description Recombinant Human TRPC6 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ
Molecular Weight 31 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed