Recombinant Human TRPC1 Protein

Beta LifeScience SKU/CAT #: BLA-9268P
Recombinant Human TRPC1 Protein

Recombinant Human TRPC1 Protein

Beta LifeScience SKU/CAT #: BLA-9268P
Catalog No.: BLA-9268P

Product Overview

Host Species Human
Accession P48995-2
Synonym HTRP 1 HTRP1 MGC133334 MGC133335 Mtrp1 Short transient receptor potential channel 1 Transient receptor potential canonical 1 Transient receptor potential cation channel subfamily C member 1 Transient receptor potential channel 1 Transient receptor protein 1 TRP 1 TRP 1 protein Trp related protein 1 TRP-1 TRP1 TRP1 protein TrpC1 Trpc1 transient receptor potential cation channel subfamily C member 1 TRPC1_HUMAN Trrp1
Description Recombinant Human TRPC1 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence AHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGP LQISMGQMLQDFGK
Molecular Weight 33 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed