Recombinant Human TRP2/DCT Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9267P
Recombinant Human TRP2/DCT Protein (His tag)

Recombinant Human TRP2/DCT Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9267P
Catalog No.: BLA-9267P

Product Overview

Host Species Human
Accession P40126
Synonym L dopachrome tautomerase DCT Dopachrome delta isomerase Dopachrome tautomerase Dopachrome tautomerase dopachrome delta isomerase, tyrosine related protein 2 DT EC 5.3.3.12 L dopachrome Delta isomerase L-dopachrome Delta-isomerase L-dopachrome tautomerase TRP 2 TRP-2 TRP2 Tyrosinase related protein 2 Tyrosinase-related protein 2 TYRP2 TYRP2_HUMAN
Description Recombinant Human TRP2/DCT Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment
Source Baculovirus infected insect cells
AA Sequence QFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSG PYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKP PVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQ PQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYH LLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLI SRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLK DIRDCLSLQKFDNPPFFQNSTFSFRNALEGFDKADGTLDSQVMSLHNLVH SFLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQELAP IGHNRMYNMVPFFPPVTNEELFLTSDQLGYSYAIDLPVSVEETPGWPTTH HHHHH
Molecular Weight 52 kDa including tags
Purity >90% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed