Recombinant Human TRP2/DCT Protein

Beta LifeScience SKU/CAT #: BLA-9266P
Recombinant Human TRP2/DCT Protein

Recombinant Human TRP2/DCT Protein

Beta LifeScience SKU/CAT #: BLA-9266P
Catalog No.: BLA-9266P

Product Overview

Host Species Human
Accession P40126
Synonym L dopachrome tautomerase DCT Dopachrome delta isomerase Dopachrome tautomerase Dopachrome tautomerase dopachrome delta isomerase, tyrosine related protein 2 DT EC 5.3.3.12 L dopachrome Delta isomerase L-dopachrome Delta-isomerase L-dopachrome tautomerase TRP 2 TRP-2 TRP2 Tyrosinase related protein 2 Tyrosinase-related protein 2 TYRP2 TYRP2_HUMAN
Description Recombinant Human TRP2/DCT Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence CTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCK FGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITT
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed