Recombinant Human TRP2/DCT Protein

Name: Recombinant Human TRP2/DCT Protein
Brand: Beta LifeScience
SKU: BLA-9266P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P40126
Synonym	L dopachrome tautomerase DCT Dopachrome delta isomerase Dopachrome tautomerase Dopachrome tautomerase dopachrome delta isomerase, tyrosine related protein 2 DT EC 5.3.3.12 L dopachrome Delta isomerase L-dopachrome Delta-isomerase L-dopachrome tautomerase TRP 2 TRP-2 TRP2 Tyrosinase related protein 2 Tyrosinase-related protein 2 TYRP2 TYRP2_HUMAN
Description	Recombinant Human TRP2/DCT Protein was expressed in Wheat germ. It is a Protein fragment
Source	Wheat germ
AA Sequence	CTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCK FGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITT
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Catalyzes the conversion of L-dopachrome into 5,6-dihydroxyindole-2-carboxylic acid (DHICA).
Subcellular Location	Melanosome membrane; Single-pass type I membrane protein. Melanosome.
Protein Families	Tyrosinase family
Database References	HGNC: 2709 OMIM: 191275 KEGG: hsa:1638 UniGene: Hs.301865

Gene Functions References

High DCT expression is associated with progressive multiple sclerosis. PMID: 28923927
High DCT expression is associated with HPV16 Infection. PMID: 28095444
Data indicate that the caveolin-1 (CAV1) control on dopachrome tautomerase (DCT) gene expression, DCT post-translational processing, and subcellular distribution is cell phenotype-dependent. PMID: 27053106
The effect of DCT on UVR DNA damage responses and survival pathways in melanocytes was examined by knockdown experiments using melanoma cells, neonatal melanoblasts in monoculture and in co-culture with keratinocytes. PMID: 25346513
Report dopachrome tautomerase expression in mealanocytic tumors. PMID: 24709887
The results suggested that the miRNAs may be involved in MITF regulation of TYR, TYRP1 and TYRP2, which provides a new clue for understanding the role of miRNAs in melanocyte dysfunctional disease. PMID: 22898827
Data suggest that macrophage migration inhibitory factor (MIF) and d-dopachrome tautomerase (d-DT) act cooperatively to inhibit steady-state phosphorylation and activation of AMPK in LKB1 wild type and LKB1 mutant non-small cell lung carcinomas cells. PMID: 22988252
human TRP2 counteracts apoptotic cell death induction, possibly by means of its L-dopachrome tautomerase activity, and negatively affects the p53 pathway PMID: 20520707
Trp2 SNP2 allele is a risk factor for the development and severity of degenerative disc disease in a Chinese Han population. PMID: 20356546
Data suggest that OTX2 may regulate retinal pigment epithelium (RPE)-specific target genes, such as DOPAchrome tautomerase (DCT), thereby maintaining the homeostasis of RPE. PMID: 12559959
Because TRP-2(181-190) overlaps with the known HLA-A*0201-presented epitope TRP-2(180-188), an 11mer peptide encompassing both epitopes might be of specific value for vaccination of a broad population of melanoma patients. PMID: 15856458
Transgenic Dct regulates neural progenitor cell proliferation in a mouse model. PMID: 16857183
No genetic susceptibility or increased risk attributed to the tyrosinase gene family in Vogt-Koyanagi-Harada disease in Japanese. PMID: 17200659
Anemonin, an active compound of C. crassifolia, inhibits melanin synthesis by inhibiting the transcription of the genes encoding TYR, TRP1, and TRP2. PMID: 17766092
we studied a possible role of dopachrome tautomerase in the oxidative stress response in the amelanotic WM35 melanoma cell line. PMID: 18206123
We observe strong evidence for positive selection for DCT in Asians PMID: 18312627
Tyrosinase-, gp100-, or TRP-2-specific CD8(+) T cells could not be identified in the peripheral blood of individuals with vitiligo [TRP-2]. PMID: 18337837
TRP-2 acts on quinone metabolites other than DOPAchrome, e.g., in the catecholamine pathway, and limits their deleterious effects. PMID: 18674612
tyrosinase-related protein 2 (TRP-2) transcript is not detected in the peripheral blood mononuclear cells (PBMC) of vitiligo patients PMID: 19284502
Expression profiling demonstrated that the DCT-expressing cell population expressed adrenergic and muscarinic receptors and displayed transcriptional profiles distinct from dermal melanocytes PMID: 19855129

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.