Recombinant Human TRP14 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9264P
Recombinant Human TRP14 Protein (Tagged)

Recombinant Human TRP14 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9264P
Catalog No.: BLA-9264P

Product Overview

Host Species Human
Accession Q9BRA2
Synonym 14 kDa thioredoxin-related protein Protein 42-9-9 Thioredoxin domain-containing protein 17 Thioredoxin-like protein 5 TRP14 TXD17_HUMAN TXNDC17
Description Recombinant Human TRP14 Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAE PVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYG TPQKLVESECLQANLVEMLFSED
Molecular Weight 41 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed