Recombinant Human TRP1 Protein

Beta LifeScience SKU/CAT #: BLA-9261P
Recombinant Human TRP1 Protein

Recombinant Human TRP1 Protein

Beta LifeScience SKU/CAT #: BLA-9261P
Catalog No.: BLA-9261P

Product Overview

Host Species Human
Accession P17643
Synonym 5 5,6 dihydroxyindole 2 carboxylic acid oxidase 6-dihydroxyindole-2-carboxylic acid oxidase b-PROTEIN CAS2 Catalase B CATB DHICA oxidase Glycoprotein 75 GP75 Melanoma antigen gp75 OCA3 TRP TRP-1 TRP1 Tyrosinase related protein 1 Tyrosinase-related protein 1 TYRP TYRP1 TYRP1_HUMAN TYRRP
Description Recombinant Human TRP1 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSG PGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCH CNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDM AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF LGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWN FATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLG TLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSN STNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIF VLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNT EMFVTAPDNLGYTYEIQWPSREFSVPEIIAIAVVGALLLVALIFGTASYL IRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV
Molecular Weight 87 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed