Recombinant Human TROY Protein

Beta LifeScience SKU/CAT #: BLA-9260P
Recombinant Human TROY Protein

Recombinant Human TROY Protein

Beta LifeScience SKU/CAT #: BLA-9260P
Catalog No.: BLA-9260P

Product Overview

Host Species Human
Synonym AL023044 AW123854 TAJ TAJ alpha TAJ-alpha TNFRSF19 TNFRSF19 tumor necrosis factor receptor superfamily, member 19 TNR19_HUMAN Toxicity and JNK inducer TRADE TROY Tumor necrosis factor receptor superfamily member 19 UNQ1888/PRO4333
Description Recombinant Human TROY Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCN QCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNR FQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCA SKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEK KPSWSLRSQDIQYNGSELSCFDRPQLHEYAHRACCQCRRDSVQTCGPVRL LPSMCCEEACSPNPATLGCGVHSAASLQARNAGPAGEMVPTFFGSLTQSI CGEFSDAWPLMQNPMGGDNISFCDSYPELTGEDIHSLNPELESSTSLDSN SSQDLVGGAVPVQSHSENFTAATDLSRYNNTLVESASTQDALTMRSQLDQ ESGAVIHPATQTSLQEA
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed