Recombinant Human Tropomyosin + ALK Protein fusion Protein
Beta LifeScience
SKU/CAT #: BLA-10105P
Recombinant Human Tropomyosin + ALK Protein fusion Protein
Beta LifeScience
SKU/CAT #: BLA-10105P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P09493Q9UM73 |
Description | Recombinant Human Tropomyosin + ALK Protein fusion Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKL KGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELD RAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKE AKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTV TNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLE KSIDDLE |
Purity | >70% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity ofthis protein was22 nmol/min/mg in akinase assay usingIGF1Rtidesynthetic peptide (KKKSPGEYVNIEFG) as substrate. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |