Recombinant Human TrkB Protein

Beta LifeScience SKU/CAT #: BLA-9235P
Recombinant Human TrkB Protein

Recombinant Human TrkB Protein

Beta LifeScience SKU/CAT #: BLA-9235P
Catalog No.: BLA-9235P

Product Overview

Host Species Human
Accession Q16620
Synonym AI848316 BDNF tropomyosine receptor kinase B BDNF/NT 3 growth factors receptor BDNF/NT-3 growth factors receptor Brain derived neurotrophic factor receptor C030027L06Rik EC 2.7.10.1 GP145 TrkB GP145-TrkB GP145-TrkB/GP95-TrkB GP95 TrkB Neurotrophic receptor tyrosine kinase 2 Neurotrophic tyrosine kinase receptor type 2 Neurotrophin receptor tyrosine kinase type 2 NTRK 2 Ntrk2 NTRK2_HUMAN Obesity, hyperphagia, and developmental delay, included RATTRKB1 Tkrb Trk B Trk-B TRKB TrkB tyrosine kinase TRKB1 Tropomyosin related kinase B tyrosine kinase receptor B Tyrosine receptor kinase B
Description Recombinant Human TrkB Protein was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence CPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEI INEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLS RKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESS KNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWD VGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNL TVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYIC TKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGW PGIDDGANPN YPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHVDHHHHHH
Molecular Weight 45 kDa including tags
Purity >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C.
Recently viewed