Recombinant Human TrkB Protein
Beta LifeScience
SKU/CAT #: BLA-9235P
Recombinant Human TrkB Protein
Beta LifeScience
SKU/CAT #: BLA-9235P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q16620 |
Synonym | AI848316 BDNF tropomyosine receptor kinase B BDNF/NT 3 growth factors receptor BDNF/NT-3 growth factors receptor Brain derived neurotrophic factor receptor C030027L06Rik EC 2.7.10.1 GP145 TrkB GP145-TrkB GP145-TrkB/GP95-TrkB GP95 TrkB Neurotrophic receptor tyrosine kinase 2 Neurotrophic tyrosine kinase receptor type 2 Neurotrophin receptor tyrosine kinase type 2 NTRK 2 Ntrk2 NTRK2_HUMAN Obesity, hyperphagia, and developmental delay, included RATTRKB1 Tkrb Trk B Trk-B TRKB TrkB tyrosine kinase TRKB1 Tropomyosin related kinase B tyrosine kinase receptor B Tyrosine receptor kinase B |
Description | Recombinant Human TrkB Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | CPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEI INEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLS RKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESS KNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWD VGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNL TVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYIC TKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGW PGIDDGANPN YPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHVDHHHHHH |
Molecular Weight | 45 kDa including tags |
Purity | >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. |