Recombinant Human TRIM68 Protein

Beta LifeScience SKU/CAT #: BLA-9207P
Recombinant Human TRIM68 Protein

Recombinant Human TRIM68 Protein

Beta LifeScience SKU/CAT #: BLA-9207P
Catalog No.: BLA-9207P

Product Overview

Host Species Human
Synonym E3 ubiquitin-protein ligase TRIM68 FLJ10369 GC109 MGC126176 RING finger protein 137 RNF 137 RNF137 Ro/SSA1 related protein SS 56 SS-56 SS56 SSA protein SS 56 SSA protein SS-56 TRI68_HUMAN TRIM 68 Trim68 Tripartite motif containing 68 Tripartite motif containing protein 68 Tripartite motif-containing protein 68
Description Recombinant Human TRIM68 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence KQSIVWEFEKYQRLLEKKQPPHRQLGAEVAAALASLQREAAETMQKLELN HSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEP
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed