Recombinant Human TRIM5 delta Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9205P
Recombinant Human TRIM5 delta Protein (His tag)

Recombinant Human TRIM5 delta Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9205P
Catalog No.: BLA-9205P

Product Overview

Host Species Human
Accession Q9C035
Synonym EG667823 Gm8833 RING finger protein 88 RNF88 TRIM5 TRIM5_HUMAN Tripartite motif containing 5 transcript variant iota Tripartite motif containing 5 transcript variant kappa Tripartite motif containing protein 5 Tripartite motif protein TRIM5 Tripartite motif-containing protein 5
Description Recombinant Human TRIM5 delta Protein (His tag) was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence MGSSHHHHHHSSGLVPRGSHMASGILVNVKEEVTCPICLELLTQPLSLDC GHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVEKL REVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFL TEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTN VLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRE LISDLEHRLQGSVMELLQ
Molecular Weight 31 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C.
Recently viewed