Recombinant Human TREML2 Protein

Beta LifeScience SKU/CAT #: BLA-9181P
Recombinant Human TREML2 Protein

Recombinant Human TREML2 Protein

Beta LifeScience SKU/CAT #: BLA-9181P
Catalog No.: BLA-9181P

Product Overview

Host Species Human
Accession Q5T2D2
Synonym C6orf76 Chromosome 6 open reading frame 76 FLJ13693 MGC149715 MGC149716 TLT 2 TLT2 TREM like transcript 2 Trem like transcript 2 protein Triggering receptor expressed on myeloid cells like 2 Triggering receptor expressed on myeloid cells like protein 2
Description Recombinant Human TREML2 Protein was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence GPSADSVYTKVRLLEGETLSVQCSYKGYKNRVEGKVWCKIRKKKCEPGFA RVWVKGPRYLLQDDAQAKVVNITMVALKLQDSGRYWCMRNTSGILYPLMG FQLDVSPAPQSERNIPFTHLDNILKSGTVTTGQAPTSGPDAPFTTGVMVF TPGLITLPRLLASTRPASKTGYSFTATSTTSQGPRRTMGSQTVTASPSNA RDSSAGPESISTKSGDLSTRSPTTGLCLTSRSLLNRLPSMPSIRHQDVYS VDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight 54 kDa including tags
Purity >95% SDS-PAGE.Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. The lyo
Recently viewed