Recombinant Human TRC40 Protein

Beta LifeScience SKU/CAT #: BLA-9175P
Recombinant Human TRC40 Protein

Recombinant Human TRC40 Protein

Beta LifeScience SKU/CAT #: BLA-9175P
Catalog No.: BLA-9175P

Product Overview

Host Species Human
Accession O43681
Synonym ARSA ARSA 1 ArsA arsenite transporter ATP binding homolog 1 ArsA arsenite transporter, ATP binding, E. coli, homolog of, 1 ArsA arsenite transporter, ATP-binding, homolog 1 (bacterial) ARSA I ARSA-I ARSA1 ARSAI Arsenical pump driving ATPase Arsenical pump-driving ATPase Arsenical resistance ATPase Arsenite translocating ATPase Arsenite transporting ATPase Arsenite-stimulated ATPase ASNA 1 ASNA I ASNA-I ASNA_HUMAN ASNA1 Asna1 protein ASNAI ATPase ASNA1 GET3 Golgi to ER traffic 3 homolog hARSA-I hASNA-I MGC3821 Transmembrane domain recognition complex 40 kDa ATPase subunit Transmembrane domain recognition complex, 40kDa TRC40
Description Recombinant Human TRC40 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMAAGVAGWGVEAEEFEDAPDVEPLEPT LSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAH NISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFEEDNMLSM GKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLL NFPTIVERGLGRLMQIKNQISPFISQMCNMLGLGDMNADQLASKLEETLP VIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIV NQLVFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRG ADKVNTFSALLLEPYKPPSAQ
Molecular Weight 41 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed