Recombinant Human Transportin 1/MIP Protein
Beta LifeScience
SKU/CAT #: BLA-9171P
Recombinant Human Transportin 1/MIP Protein
Beta LifeScience
SKU/CAT #: BLA-9171P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q92973-2 |
Synonym | Importin 2 Importin beta 2 Importin beta-2 IPO 2 IPO2 Karyopherin (importin) beta 2 Karyopherin beta 2 Karyopherin beta-2 KPN B2 KPNB 2 KPNB2 M9 interacting protein M9 region interacting protein M9 region interaction protein MIP MIP 1 MIP1 OTTHUMP00000126960 OTTHUMP00000222024 OTTHUMP00000226224 TNPO 1 Tnpo1 TNPO1_HUMAN Transportin Transportin 1 Transportin-1 Transportin1 TRN |
Description | Recombinant Human Transportin 1/MIP Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | PDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKN NVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQ NWPDLLPKLCSLLDSED* |
Molecular Weight | 39 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |