Recombinant Human Transportin 1/MIP Protein

Beta LifeScience SKU/CAT #: BLA-9171P
Recombinant Human Transportin 1/MIP Protein

Recombinant Human Transportin 1/MIP Protein

Beta LifeScience SKU/CAT #: BLA-9171P
Catalog No.: BLA-9171P

Product Overview

Host Species Human
Accession Q92973-2
Synonym Importin 2 Importin beta 2 Importin beta-2 IPO 2 IPO2 Karyopherin (importin) beta 2 Karyopherin beta 2 Karyopherin beta-2 KPN B2 KPNB 2 KPNB2 M9 interacting protein M9 region interacting protein M9 region interaction protein MIP MIP 1 MIP1 OTTHUMP00000126960 OTTHUMP00000222024 OTTHUMP00000226224 TNPO 1 Tnpo1 TNPO1_HUMAN Transportin Transportin 1 Transportin-1 Transportin1 TRN
Description Recombinant Human Transportin 1/MIP Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence PDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKN NVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQ NWPDLLPKLCSLLDSED*
Molecular Weight 39 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed