Recombinant Human Translin/TSN Protein

Beta LifeScience SKU/CAT #: BLA-9169P
Recombinant Human Translin/TSN Protein

Recombinant Human Translin/TSN Protein

Beta LifeScience SKU/CAT #: BLA-9169P
Catalog No.: BLA-9169P

Product Overview

Host Species Human
Accession Q15631
Synonym BCLF 1 BCLF1 Component 3 of promoter of RISC RCHF1 recombination hotspot associated factor recombination hotspot binding protein rehf 1 REHF1 TBRBP Translin TRSLN TSN TSN_HUMAN
Description Recombinant Human Translin/TSN Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAG FQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVF LAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASE LSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKY DVKKVEEVVYDLSIRGFNKETAAACVEK
Molecular Weight 26 kDa
Purity >90% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed