Recombinant Human Translin/TSN Protein
Beta LifeScience
SKU/CAT #: BLA-9169P
Recombinant Human Translin/TSN Protein
Beta LifeScience
SKU/CAT #: BLA-9169P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q15631 |
Synonym | BCLF 1 BCLF1 Component 3 of promoter of RISC RCHF1 recombination hotspot associated factor recombination hotspot binding protein rehf 1 REHF1 TBRBP Translin TRSLN TSN TSN_HUMAN |
Description | Recombinant Human Translin/TSN Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAG FQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVF LAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASE LSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKY DVKKVEEVVYDLSIRGFNKETAAACVEK |
Molecular Weight | 26 kDa |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |