Recombinant Human Transferrin Protein

Beta LifeScience SKU/CAT #: BLA-9161P
Recombinant Human Transferrin Protein

Recombinant Human Transferrin Protein

Beta LifeScience SKU/CAT #: BLA-9161P
Catalog No.: BLA-9161P

Product Overview

Host Species Human
Synonym Apotransferrin Beta 1 metal binding globulin Beta-1 metal-binding globulin DKFZp781D0156 PRO1400 PRO1557 PRO2086 Serotransferrin Serotransferrin precursor Siderophilin TF TFQTL1 Transferin Transferrin TRFE_HUMAN
Description Recombinant Human Transferrin Protein was expressed in HEK293. It is a Full length protein
Source HEK293
AA Sequence Theoretical sequence: VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYL DCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTF YYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEP RKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSG AFKCLKNGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEY KDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFS SPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCQEA PTDECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIM NGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCEDTPEAGYFAVA VVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDE FFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVE KGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEY ANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLF RSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSL LEACTFRRP
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity The activity of ab83560 was measured by its ability to support the growth of HepG2 cells under conditions of reduced serum. Typically 0.1 to 1 µg enhances cell proliferation.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. After reconstitution store at -20°C. Avoid freeze / thaw cycle.
Recently viewed