Recombinant Human TRAIL Protein

Beta LifeScience SKU/CAT #: BLA-9156P
Recombinant Human TRAIL Protein

Recombinant Human TRAIL Protein

Beta LifeScience SKU/CAT #: BLA-9156P
Catalog No.: BLA-9156P

Product Overview

Host Species Human
Accession P50591
Synonym Apo 2 ligand APO 2L Apo-2 ligand Apo-2L APO2L CD253 CD253 antigen Chemokine tumor necrosis factor ligand superfamily member 10 Protein TRAIL TL2 TNF Related Apoptosis Inducing Ligand TNF related apoptosis inducing ligand TRAIL TNF-related apoptosis-inducing ligand TNF10_HUMAN TNFSF10 TRAIL Tumor necrosis factor (ligand) family member 10 Tumor Necrosis Factor (ligand) Superfamily Member 10 Tumor necrosis factor apoptosis inducing ligand splice variant delta Tumor necrosis factor ligand superfamily member 10
Description Recombinant Human TRAIL Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHS FLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYK YTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTN EHLIDMDHEASFFGAFLVGLEHHHHHH
Molecular Weight 21 kDa including tags
Purity >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Reconstitute for long term storage.
Recently viewed