Recombinant Human TRAIL Protein

Beta LifeScience SKU/CAT #: BLA-9152P
Recombinant Human TRAIL Protein

Recombinant Human TRAIL Protein

Beta LifeScience SKU/CAT #: BLA-9152P
Catalog No.: BLA-9152P

Product Overview

Host Species Human
Accession P50591
Synonym Apo 2 ligand APO 2L Apo-2 ligand Apo-2L APO2L CD253 CD253 antigen Chemokine tumor necrosis factor ligand superfamily member 10 Protein TRAIL TL2 TNF Related Apoptosis Inducing Ligand TNF related apoptosis inducing ligand TRAIL TNF-related apoptosis-inducing ligand TNF10_HUMAN TNFSF10 TRAIL Tumor necrosis factor (ligand) family member 10 Tumor Necrosis Factor (ligand) Superfamily Member 10 Tumor necrosis factor apoptosis inducing ligand splice variant delta Tumor necrosis factor ligand superfamily member 10
Description Recombinant Human TRAIL Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNE KALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQE EIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQ GGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
Molecular Weight 28 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Bind this protein with a cross-linking enhancer. Note: Recombinant Human TRAIL Protein does not significantly induce apoptosis in the absence of an enhancer.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C.
Recently viewed