Recombinant Human TPA Tissue Plasminogen Activator Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9118P
Recombinant Human TPA Tissue Plasminogen Activator Protein (His tag)

Recombinant Human TPA Tissue Plasminogen Activator Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9118P
Catalog No.: BLA-9118P

Product Overview

Host Species Human
Accession P00750
Synonym Alteplase DKFZp686I03148 Plasminogen activator tissue Plasminogen activator tissue type PLAT Reteplase t PA T Plasminogen Activator t-PA T-plasminogen activator Tissue plasminogen activator (t PA) Tissue type plasminogen activator Tissue-type plasminogen activator chain B tPA TPA_HUMAN TPA1
Description Recombinant Human TPA Tissue Plasminogen Activator Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment
Source Baculovirus infected insect cells
AA Sequence ADPSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVP VKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQG ISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNP DRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTES GASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLK NRRLTWEYCDVPSCSTCGLRQYSQPQFRHHHHHH
Molecular Weight 32 kDa including tags
Purity >90% SDS-PAGE.Purified using conventional chromatography techniques.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed