Recombinant Human TOM1 Protein

Beta LifeScience SKU/CAT #: BLA-9095P
Recombinant Human TOM1 Protein

Recombinant Human TOM1 Protein

Beta LifeScience SKU/CAT #: BLA-9095P
Catalog No.: BLA-9095P

Product Overview

Host Species Human
Synonym FLJ33404 OTTHUMP00000028777 Target of myb 1 Target of Myb protein 1 Target of myb1 TOM 1 TOM1 TOM1_HUMAN
Description Recombinant Human TOM1 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDA LRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLV RTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLE FPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPA PPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPAD LELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHER FERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVR AGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALD ARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEGKFDKFLEE RAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed